Description
Quick order process

We invite you to purchase this product. If you have any questions, please contact us. Our specialists will certainly advise the best solution.

Details

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Peptide sequence

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH

Description

Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus.

Storage conditions

Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Package form

Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Reconstitution conditions

See included datasheet or contact us for more information.

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Source

Recombinants or rec. proteins

Shipping condition

Dry ice/ice packs

Group

recombinants

Origin

Human Cells

Estimated molecular weight

44,1 kDa

UniProt number

P06732

Tissue

muscle

Species reactivity

Human