Description
Back to: Our Contractors / novo / Recombinant Human Creatine Kinase, Muscle/CKMM (C-6His)
Size
500 ug
Catalog no
CC96-500
The best quality, top prices of Gentaur Human RBP ELISA Kit test and else products, the best delivery.
Back to: Our Contractors / novo / Recombinant Human Creatine Kinase, Muscle/CKMM (C-6His)
500 ug
CC96-500
We invite you to purchase this product. If you have any questions, please contact us. Our specialists will certainly advise the best solution.
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH
Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus.
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
See included datasheet or contact us for more information.
Greater than 95% as determined by reducing SDS-PAGE.
Recombinants or rec. proteins
Dry ice/ice packs
recombinants
Human cells
44,1 kDa
P06732
muscle
Human